PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0159s0017.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family Trihelix
Protein Properties Length: 324aa    MW: 38191.7 Da    PI: 6.2433
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0159s0017.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix699.1e-2241106166
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkike 66 
                          +W  +e+++ i++r e+e+++ ++k++k+lWe ++ km+e+gf+rs+ qCk+kw+nl +ryk   e
  Mapoly0159s0017.1.p  41 QWGYHETKEFIAIRAELEKDFTQTKRNKTLWELIAGKMKEKGFRRSADQCKCKWKNLVNRYKGFDE 106
                          7*************************************************************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.8533498IPR017877Myb-like domain
CDDcd122033.83E-2740103No hitNo description
PfamPF138371.0E-1741106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MIGENLAIMA PLPLQASPTV TGEISAVTPG RGRRKEDRIP QWGYHETKEF IAIRAELEKD  60
FTQTKRNKTL WELIAGKMKE KGFRRSADQC KCKWKNLVNR YKGFDEASDF SPLSQLSARV  120
DDELASEHCV IGKETSEPDN GRQCAFFEEL DAIFKERAKN MDRLLLESES GSRPKKKAKR  180
VKRILGGVKS SDDDTEDEED EEADSEDERI VRRKKRKADK ERQRVTAEKY RANSMQEVLE  240
DFFQQQQRVE DQWREGVERR EHERRMREQE WREAMEKLEQ ERLLREQEWR EREDQRRARE  300
EARAEKRDDL FAALISKLTQ HDG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001780737.11e-110predicted protein
TrEMBLA9P2A31e-112A9P2A3_PICSI; Putative uncharacterized protein
STRINGPP1S285_47V6.11e-114(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22621535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-28Trihelix family protein